Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cbs, Mouse (His)

Product Specifications

Product Name Alternative

Cbs Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Smiles

PSGTSQCEDGSAGGFQHLDMHSEKRQLEKGPSGDKDRVWIRPDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARELQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFVAAREQTQT

Molecular Formula

12411 (Gene_ID) Q91WT9 (P2-T561) (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ZC2HC1A sgRNA gene knockout kit - Lentiviral human ZC2HC1A sgRNA gene knockout kit (plasmid)
GTR15380912 1 Vial

Lentiviral human ZC2HC1A sgRNA gene knockout kit - Lentiviral human ZC2HC1A sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Mouse Autophagy Related Protein 16 Like Protein 1 (ATG16L1) ELISA Kit
YP-W24066-01 48 Tests

Mouse Autophagy Related Protein 16 Like Protein 1 (ATG16L1) ELISA Kit

Sign In for Pricing
View Details
Mouse Autophagy Related Protein 16 Like Protein 1 (ATG16L1) ELISA Kit
YP-W24066-02 96 Tests

Mouse Autophagy Related Protein 16 Like Protein 1 (ATG16L1) ELISA Kit

Sign In for Pricing
View Details
(4,6-Dichloropyridin-3-yl) boronic acid
433803-01 25 mg

(4,6-Dichloropyridin-3-yl) boronic acid

Sign In for Pricing
View Details
(4,6-Dichloropyridin-3-yl) boronic acid
433803-02 50 mg

(4,6-Dichloropyridin-3-yl) boronic acid

Sign In for Pricing
View Details
CQ31
E1138-5mg 5 mg

CQ31

Sign In for Pricing
View Details