Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cbs, Mouse (His)

Product Specifications

Product Name Alternative

Cbs Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Smiles

PSGTSQCEDGSAGGFQHLDMHSEKRQLEKGPSGDKDRVWIRPDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARELQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFVAAREQTQT

Molecular Formula

12411 (Gene_ID) Q91WT9 (P2-T561) (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Inhibin beta C chain (INHBC), partial
orb2658901-01 20 µg

Recombinant Human Inhibin beta C chain (INHBC), partial

Sign In for Pricing
View Details
Recombinant Human Inhibin beta C chain (INHBC), partial
orb2658901-02 100 µg

Recombinant Human Inhibin beta C chain (INHBC), partial

Sign In for Pricing
View Details
Recombinant Human Inhibin beta C chain (INHBC), partial
orb2658901-03 1 mg

Recombinant Human Inhibin beta C chain (INHBC), partial

Sign In for Pricing
View Details
Recombinant Synechococcus sp. NAD(P)H-quinone oxidoreductase subunit L (ndhL)
MBS7023193-01 0.02 mg

Recombinant Synechococcus sp. NAD(P)H-quinone oxidoreductase subunit L (ndhL)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. NAD(P)H-quinone oxidoreductase subunit L (ndhL)
MBS7023193-02 0.1 mg

Recombinant Synechococcus sp. NAD(P)H-quinone oxidoreductase subunit L (ndhL)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. NAD(P)H-quinone oxidoreductase subunit L (ndhL)
MBS7023193-03 5x 0.1 mg

Recombinant Synechococcus sp. NAD(P)H-quinone oxidoreductase subunit L (ndhL)

Sign In for Pricing
View Details