Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sting1, Mouse (Cell-Free, His)

Product Specifications

Product Name Alternative

Sting1 Protein, Mouse (Cell-Free, His), Mouse, E. coli Cell-free

UNSPSC

12352202

Purity

90

Smiles

MPYSNLHPAIPRPRGHRSKYVALIFLVASLMILWVAKDPPNHTLKYLALHLASHELGLLLKNLCCLAEELCHVQSRYQGSYWKAVRACLGCPIHCMAMILLSSYFYFLQNTADIYLSWMFGLLVLYKSLSMLLGLQSLTPAEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEEKEEVTMNAPMTSVAPPPSVLSQEPRLLISGMDQPLPLRTDLI

Molecular Formula

72512 (Gene_ID) Q3TBT3 (M1-I378) (Accession)

Molecular Weight

Approximately 45 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRSF7-set siRNA/shRNA/RNAi Lentivector (Human)
45522091 4x 500 ng

SRSF7-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Histone H1 Blocking Peptide
abx062717-01 1 mg

Histone H1 Blocking Peptide

Sign In for Pricing
View Details
Histone H1 Blocking Peptide
abx062717-02 5 mg

Histone H1 Blocking Peptide

Sign In for Pricing
View Details
Monkey Peripherin ELISA Kit
MBS7272034-01 48 Well

Monkey Peripherin ELISA Kit

Sign In for Pricing
View Details
Monkey Peripherin ELISA Kit
MBS7272034-02 96 Well

Monkey Peripherin ELISA Kit

Sign In for Pricing
View Details
Monkey Peripherin ELISA Kit
MBS7272034-03 5x 96 Well

Monkey Peripherin ELISA Kit

Sign In for Pricing
View Details