Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sting1, Mouse (Cell-Free, His)

Product Specifications

Product Name Alternative

Sting1 Protein, Mouse (Cell-Free, His), Mouse, E. coli Cell-free

UNSPSC

12352202

Purity

90

Smiles

MPYSNLHPAIPRPRGHRSKYVALIFLVASLMILWVAKDPPNHTLKYLALHLASHELGLLLKNLCCLAEELCHVQSRYQGSYWKAVRACLGCPIHCMAMILLSSYFYFLQNTADIYLSWMFGLLVLYKSLSMLLGLQSLTPAEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEEKEEVTMNAPMTSVAPPPSVLSQEPRLLISGMDQPLPLRTDLI

Molecular Formula

72512 (Gene_ID) Q3TBT3 (M1-I378) (Accession)

Molecular Weight

Approximately 45 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRAK1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1097507 1.0 µg DNA

IRAK1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ABHD12 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV680276 1.0 µg DNA

ABHD12 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
CCDC38, ID (CCDC38, Coiled-coil domain-containing protein 38) (APC) discontinued
033321-APC 200 µL

CCDC38, ID (CCDC38, Coiled-coil domain-containing protein 38) (APC) discontinued

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 7 (CD7)
MBS2059007-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 7 (CD7)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 7 (CD7)
MBS2059007-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 7 (CD7)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 7 (CD7)
MBS2059007-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 7 (CD7)

Sign In for Pricing
View Details