Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPAR gamma, Mouse (His)

Product Specifications

Product Name Alternative

PPAR gamma Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Smiles

MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY

Molecular Formula

19016 (Gene_ID) P37238 (M1-Y505) (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzyl (5-oxopentyl) carbamate
orb3176124-01 10 mg

Benzyl (5-oxopentyl) carbamate

Sign In for Pricing
View Details
Benzyl (5-oxopentyl) carbamate
orb3176124-02 50 mg

Benzyl (5-oxopentyl) carbamate

Sign In for Pricing
View Details
GRIN2A Human Pre-designed siRNA Set A
HY-RS05804 1 Set

GRIN2A Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
ATP6V0A2 Rabbit Polyclonal Antibody (BF750)
orb2531228 100 µL

ATP6V0A2 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Mouse Anti Human Cd19 Monoclonal Antibody,Pacific Blue®
CABT-48717MH 0.25ml

Mouse Anti Human Cd19 Monoclonal Antibody,Pacific Blue®

Sign In for Pricing
View Details
Isohematoporphyrin IX
sc-263413A 50 mg

Isohematoporphyrin IX

Sign In for Pricing
View Details