Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1B, Human (GST)

Product Specifications

Product Name Alternative

IL-1 beta Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Smiles

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Molecular Formula

3553 (Gene_ID) P01584 (A117-S269) (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZIC5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV639742 1.0 µg DNA

ZIC5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
SLC15A2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
43887061 1.0 µg DNA

SLC15A2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Stk40 sgRNA CRISPR Lentivector set (Mouse)
K4693801 3x 1.0 µg

Stk40 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal CRABP2 Antibody [Janelia Fluor 646]
NBP2-99740JF646 0.1 mL

Rabbit Polyclonal CRABP2 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
G3BP1, Phosphorylated (S232) (Ras GTPase-Activating Protein-Binding Protein 1, G3BP, HDH-VIII) (Biotin)
MBS6417874-01 0.1 mL

G3BP1, Phosphorylated (S232) (Ras GTPase-Activating Protein-Binding Protein 1, G3BP, HDH-VIII) (Biotin)

Sign In for Pricing
View Details
G3BP1, Phosphorylated (S232) (Ras GTPase-Activating Protein-Binding Protein 1, G3BP, HDH-VIII) (Biotin)
MBS6417874-02 5x 0.1 mL

G3BP1, Phosphorylated (S232) (Ras GTPase-Activating Protein-Binding Protein 1, G3BP, HDH-VIII) (Biotin)

Sign In for Pricing
View Details