Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL7B, Human (His)

Product Specifications

Product Name Alternative

METTL7B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Smiles

LLGCWQPLCKSYFPYLMAVLTPKSNRKMESKKRELFSQIKGLTGASGKVALLELGCGTGANFQFYPPGCRVTCLDPNPHFEKFLTKSMAENRHLQYERFVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLFFWEHVAEPYGSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMGKAVK

Molecular Formula

196410 (Gene_ID) Q6UX53 (L24-K244) (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein Tyrosine Phosphatase, Non Receptor Type 1 (PTPN1) Magnetic Luminex Assay Kit
LKU605789 96 Tests

Protein Tyrosine Phosphatase, Non Receptor Type 1 (PTPN1) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Prkar1b (NM_001033679) Rat Tagged Lenti ORF Clone
RR209432L3 10 µg

Prkar1b (NM_001033679) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
LPS/Lipid A Antibody
ANT-36630-100ug 100 µg

LPS/Lipid A Antibody

Sign In for Pricing
View Details
Laminin 2 alpha Rabbit Polyclonal Antibody (BF405)
orb2382478 100 µL

Laminin 2 alpha Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Lentiviral mouse Sfxn2 shRNA (UAS) - Lentiviral mouse Sfxn2 shRNA (UAS, iRFP) (25)
GTR15169514 1 Vial

Lentiviral mouse Sfxn2 shRNA (UAS) - Lentiviral mouse Sfxn2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
AATF Antibody - C-terminal region : HRP (ARP38958_T100-HRP)
ARP38958_T100-HRP 100 µL

AATF Antibody - C-terminal region : HRP (ARP38958_T100-HRP)

Sign In for Pricing
View Details