Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL7B, Human (His)

Product Specifications

Product Name Alternative

METTL7B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Smiles

LLGCWQPLCKSYFPYLMAVLTPKSNRKMESKKRELFSQIKGLTGASGKVALLELGCGTGANFQFYPPGCRVTCLDPNPHFEKFLTKSMAENRHLQYERFVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLFFWEHVAEPYGSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMGKAVK

Molecular Formula

196410 (Gene_ID) Q6UX53 (L24-K244) (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Immunoglobulin G2 (IgG2) ELISA Kit
EKN46014 96 Tests

Guinea pig Immunoglobulin G2 (IgG2) ELISA Kit

Sign In for Pricing
View Details
Bluetongue virus 8
PCR-V228-01 PCR-V228-48R

Bluetongue virus 8

Sign In for Pricing
View Details
Bluetongue virus 8
PCR-V228-02 PCR-V228-96R

Bluetongue virus 8

Sign In for Pricing
View Details
LOC100039914 3'UTR Luciferase Stable Cell Line
TU111188 1.0 mL

LOC100039914 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Histone H4-Like protein type G (HIST1H4G) Human ELISA Kit
E0661 96 Tests

Histone H4-Like protein type G (HIST1H4G) Human ELISA Kit

Sign In for Pricing
View Details
ODF3 Rabbit Polyclonal Antibody (Fluoro594)
orb3093646 100 µg

ODF3 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details