Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eln, Mouse (His)

Product Specifications

Product Name Alternative

Eln Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Smiles

PLGYPIKAPKLPGGYGLPYTNGKLPYGVAGAGGKAGYPTGTGVGSQAAAAAAKAAKYGAGGAGVLPGVGGGGIPGGAGAIPGIGGIAGAGTPAAAAAAKAAAKAAKYGAAGGLVPGGPGVRLPGAGIPGVGGIPGVGGIPGVGGPGIGGPGIVGGPGAVSPAAAAKAAAKAAKYGARG

Molecular Formula

13717 (Gene_ID) P54320 (P266-G443) (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit FOR Palmitoyltransferase ZDHHC3
E3586m 96 Tests

ELISA Kit FOR Palmitoyltransferase ZDHHC3

Sign In for Pricing
View Details
ATXN7L3B 3'UTR Luciferase Stable Cell Line
TU001522 1.0 mL

ATXN7L3B 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
RSL24D1P10 3'UTR Luciferase Stable Cell Line
TU022430 1.0 mL

RSL24D1P10 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Phospho-PIK3C3 (Ser164) Polyclonal Antibody, PerCP Conjugated
bs-5581R-PerCP-TR 20 µL

Phospho-PIK3C3 (Ser164) Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
TSR2 Antibody, FITC conjugated
MBS7053035-01 0.05 mg

TSR2 Antibody, FITC conjugated

Sign In for Pricing
View Details
TSR2 Antibody, FITC conjugated
MBS7053035-02 0.1 mg

TSR2 Antibody, FITC conjugated

Sign In for Pricing
View Details