Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eln, Mouse (His)

Product Specifications

Product Name Alternative

Eln Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Smiles

PLGYPIKAPKLPGGYGLPYTNGKLPYGVAGAGGKAGYPTGTGVGSQAAAAAAKAAKYGAGGAGVLPGVGGGGIPGGAGAIPGIGGIAGAGTPAAAAAAKAAAKAAKYGAAGGLVPGGPGVRLPGAGIPGVGGIPGVGGIPGVGGPGIGGPGIVGGPGAVSPAAAAKAAAKAAKYGARG

Molecular Formula

13717 (Gene_ID) P54320 (P266-G443) (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTLL9 Protein Vector (Rat) (pPB-C-His)
PV313642 500 ng

TTLL9 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Mdivi-1
C12492-20mg 20 mg

Mdivi-1

Sign In for Pricing
View Details
DcR3 Antibody
MBS9409571-01 0.1 mL

DcR3 Antibody

Sign In for Pricing
View Details
DcR3 Antibody
MBS9409571-02 5x 0.1 mL

DcR3 Antibody

Sign In for Pricing
View Details
Lentiviral human C3orf52 shRNA (UAS) - Lentiviral human C3orf52 shRNA (UAS, GFP) (25)
GTR15148688 1 Vial

Lentiviral human C3orf52 shRNA (UAS) - Lentiviral human C3orf52 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
PSCA, ID (Prostate Stem Cell Antigen, UNQ206/PRO232) (APC)
MBS6494834-01 0.2 mL

PSCA, ID (Prostate Stem Cell Antigen, UNQ206/PRO232) (APC)

Sign In for Pricing
View Details