Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIRBP, Mouse (C-His)

Product Specifications

Product Name Alternative

CIRBP Protein, Mouse (C-His), Mouse, E. coli

UNSPSC

12352202

Smiles

MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE

Molecular Formula

12696 (Gene_ID) P60824 (M1-E172) (Accession)

Molecular Weight

Approximately 29 kDa, based on SDS-PAGE under reducing conditions

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF447 Antibody
orb1334451 100 µg

ZNF447 Antibody

Sign In for Pricing
View Details
Olfr19 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
32968124 3x 1.0µg DNA

Olfr19 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Angiopoietin 2 (ANGPT2) Mouse Monoclonal Antibody [Clone ID: LBI4A3]
AMM17339V 100 µL

Angiopoietin 2 (ANGPT2) Mouse Monoclonal Antibody [Clone ID: LBI4A3]

Sign In for Pricing
View Details
JAM2 ELISA Kit (Human) (OKBB01259)
OKBB01259 96 Well

JAM2 ELISA Kit (Human) (OKBB01259)

Sign In for Pricing
View Details
STIP1 Polyclonal Antibody, FITC Conjugated
A54794-050 50 µL

STIP1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Human Mesothelin (MSLN) (NM_005823) AAV Particle
RC202532A1V 250 µL

Human Mesothelin (MSLN) (NM_005823) AAV Particle

Sign In for Pricing
View Details