Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRD5A1, Human (Cell-Free, His)

Product Specifications

Product Name Alternative

SRD5A1 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Smiles

MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF

Molecular Formula

6715 (Gene_ID) P18405 (M1-F259) (Accession)

Molecular Weight

Approximately 32.3 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canagliflozin
TRC-C175190-5MG 5 mg

Canagliflozin

Sign In for Pricing
View Details
Human ARRDC1 activation kit by CRISPRa
GA114234 1 Kit

Human ARRDC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Phospho C-Jun (Thr91, Thr93) (C-J 4C4/1), Biotin conjugate, 0.1mg/mL
BNCB2282-100 1x 100 µL

Phospho C-Jun (Thr91, Thr93) (C-J 4C4/1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human VPS35L activation kit by CRISPRa
GA111340 1 Kit

Human VPS35L activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant RNF2 Antibody
RC-5989-01 50 μL

Recombinant RNF2 Antibody

Sign In for Pricing
View Details
Recombinant RNF2 Antibody
RC-5989-02 100 µL

Recombinant RNF2 Antibody

Sign In for Pricing
View Details