Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRD5A1, Human (Cell-Free, His)

Product Specifications

Product Name Alternative

SRD5A1 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Smiles

MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF

Molecular Formula

6715 (Gene_ID) P18405 (M1-F259) (Accession)

Molecular Weight

Approximately 32.3 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ascl3 Mouse Gene Knockout Kit (CRISPR)
KN501670 1 Kit

Ascl3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Amylin (IAPP) Human Gene Knockout Kit (CRISPR)
KN215074LP 1 Kit

Amylin (IAPP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fam32a (NM_026455) Mouse Tagged ORF Clone
MG200441 10 µg

Fam32a (NM_026455) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human XAGE2 activation kit by CRISPRa
GA106352 1 Kit

Human XAGE2 activation kit by CRISPRa

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (rPAX8/1492), CF405S conjugate, 0.1mg/mL
BNC043196-500 1x 500 µL

PAX8 (Renal Cell Marker) (rPAX8/1492), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CPSF73 (CPSF3) (NM_016207) Human Recombinant Protein
TP305834L 1 mg

CPSF73 (CPSF3) (NM_016207) Human Recombinant Protein

Sign In for Pricing
View Details