Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free SCF, Mouse

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and are critical for multiple cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates multiple signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members and PLCG1, producing signaling molecules. Animal-Free SCF Protein, Mouse is the recombinant mouse-derived Animal-Free SCF protein, expressed by E. coli, with tag free.

Product Specifications

Product Name Alternative

Animal-Free SCF Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Smiles

KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Formula

17311 (Gene_ID) P20826 (K26-A189) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IFITM2
P0671-01 50 µg

Recombinant Human IFITM2

Sign In for Pricing
View Details
Recombinant Human IFITM2
P0671-02 200 µg

Recombinant Human IFITM2

Sign In for Pricing
View Details
Recombinant Human IFITM2
P0671-03 1 mg

Recombinant Human IFITM2

Sign In for Pricing
View Details
(2R,5R) -2,5-Dimethylmorpholine HCl ee
FVB06144-01 100 mg

(2R,5R) -2,5-Dimethylmorpholine HCl ee

Sign In for Pricing
View Details
(2R,5R) -2,5-Dimethylmorpholine HCl ee
FVB06144-02 1 g

(2R,5R) -2,5-Dimethylmorpholine HCl ee

Sign In for Pricing
View Details
Recombinant Human Solute carrier family 26 member 9 (SLC26A9), partial
MBS7087579 Inquire

Recombinant Human Solute carrier family 26 member 9 (SLC26A9), partial

Sign In for Pricing
View Details