Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free SCF, Mouse

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and are critical for multiple cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates multiple signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members and PLCG1, producing signaling molecules. Animal-Free SCF Protein, Mouse is the recombinant mouse-derived Animal-Free SCF protein, expressed by E. coli, with tag free.

Product Specifications

Product Name Alternative

Animal-Free SCF Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Smiles

KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Formula

17311 (Gene_ID) P20826 (K26-A189) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEK1 (Thr292) Antibody
252555 0.1 mL

MEK1 (Thr292) Antibody

Sign In for Pricing
View Details
(1S) -2-chloro-1- (4-isopropylphenyl) ethanol
sc-334523A 5 g

(1S) -2-chloro-1- (4-isopropylphenyl) ethanol

Sign In for Pricing
View Details
Lixisenatide Biosimilar - Research Grade
ICH5649-25mg 25 mg

Lixisenatide Biosimilar - Research Grade

Sign In for Pricing
View Details
GALP Rabbit pAb
E45R23713N-50 50 µL

GALP Rabbit pAb

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS516030 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Recombinant Human CDH4 Protein, N-His
orb3154948-01 50 µg

Recombinant Human CDH4 Protein, N-His

Sign In for Pricing
View Details