Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free SCF, Mouse

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and are critical for multiple cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates multiple signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members and PLCG1, producing signaling molecules. Animal-Free SCF Protein, Mouse is the recombinant mouse-derived Animal-Free SCF protein, expressed by E. coli, with tag free.

Product Specifications

Product Name Alternative

Animal-Free SCF Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Smiles

KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Formula

17311 (Gene_ID) P20826 (K26-A189) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Classical swine fever virus Genome polyprotein
orb2903360-01 20 µg

Recombinant Classical swine fever virus Genome polyprotein

Sign In for Pricing
View Details
Recombinant Classical swine fever virus Genome polyprotein
orb2903360-02 100 µg

Recombinant Classical swine fever virus Genome polyprotein

Sign In for Pricing
View Details
Galectin-3 (N174) polyclonal antibody
BS1137-01 50 µL

Galectin-3 (N174) polyclonal antibody

Sign In for Pricing
View Details
Galectin-3 (N174) polyclonal antibody
BS1137-02 100 µL

Galectin-3 (N174) polyclonal antibody

Sign In for Pricing
View Details
Sodium Borohydride
TRC-S614900-250G 250 g

Sodium Borohydride

Sign In for Pricing
View Details
IFT172 Antibody, FITC conjugated
A70545-100UG 100 µg

IFT172 Antibody, FITC conjugated

Sign In for Pricing
View Details