Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNMT3A, Human (His, Myc)

Product Specifications

Product Name Alternative

DNMT3A Protein, Human (His, Myc), Human, E. coli

UNSPSC

12352202

Purity

90

Smiles

MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPVESGDTPKDPAVISKSPSMAQDSGASELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEGAAETLPEASRAVENGCCTPKEGRGAPAEAGESSAPGAASSGPTSIP

Molecular Formula

1788 (Gene_ID) Q9Y6K1-3 (M1-P166) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGFR3 alpha (IIIc), His & Avi, Human
Z04261-100 100 µg

FGFR3 alpha (IIIc), His & Avi, Human

Sign In for Pricing
View Details
Eph receptor B1/EPHB1 Rabbit Polyclonal Antibody (Fluoro594)
orb3076717 100 µg

Eph receptor B1/EPHB1 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
SEPX1 Protein Vector (Human) (pPM-C-HA)
PV037439 500 ng

SEPX1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
WIPI1 Rabbit Polyclonal Antibody (FITC)
orb2099328 100 µL

WIPI1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CBFB siRNA (Mouse)
CRM0529-01 15 nmol

CBFB siRNA (Mouse)

Sign In for Pricing
View Details
CBFB siRNA (Mouse)
CRM0529-02 30 nmol

CBFB siRNA (Mouse)

Sign In for Pricing
View Details