Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNMT3A, Human (His, Myc)

Product Specifications

Product Name Alternative

DNMT3A Protein, Human (His, Myc), Human, E. coli

UNSPSC

12352202

Purity

90

Smiles

MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPVESGDTPKDPAVISKSPSMAQDSGASELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEGAAETLPEASRAVENGCCTPKEGRGAPAEAGESSAPGAASSGPTSIP

Molecular Formula

1788 (Gene_ID) Q9Y6K1-3 (M1-P166) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3 Antibody (N-term)
E45R30626G-1 100 µL

Histone H3 Antibody (N-term)

Sign In for Pricing
View Details
anti-HMGB1
YF-PA12378 100 ul

anti-HMGB1

Sign In for Pricing
View Details
C9orf68 Peptide - middle region
MBS3237610-01 0.1 mg

C9orf68 Peptide - middle region

Sign In for Pricing
View Details
C9orf68 Peptide - middle region
MBS3237610-02 5x 0.1 mg

C9orf68 Peptide - middle region

Sign In for Pricing
View Details
FOXP3 Rabbit Polyclonal Antibody (Fluoro594)
orb3120590 100 µg

FOXP3 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Recombinant Human PDIA3 Protein
ARP3317-01 10 µg

Recombinant Human PDIA3 Protein

Sign In for Pricing
View Details