TOP2A, Human
TOP2A Protein, Human is the recombinant human-derived TOP2A protein, expressed by E. coli, with tag free tag.
Product Specifications
Product Name Alternative
TOP2A Protein, Human, Human, E. coli
UNSPSC
12352202
Purity
90
Smiles
SPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDD
Molecular Formula
7153 (Gene_ID) P11388-1 (S1354-D1473) (Accession)
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1233443-01 0.02 mg (E-Coli)
Recombinant Xanthomonas oryzae pv. oryzae Adenine phosphoribosyltransferase (apt)
Sign In for Pricing
View Details MBS1233443-02 0.1 mg (E-Coli)
Recombinant Xanthomonas oryzae pv. oryzae Adenine phosphoribosyltransferase (apt)
Sign In for Pricing
View Details MBS1233443-03 0.02 mg (Yeast)
Recombinant Xanthomonas oryzae pv. oryzae Adenine phosphoribosyltransferase (apt)
Sign In for Pricing
View Details MBS1233443-04 0.1 mg (Yeast)
Recombinant Xanthomonas oryzae pv. oryzae Adenine phosphoribosyltransferase (apt)
Sign In for Pricing
View Details