TRGC2, Human (HEK293, His)
TRGC2 Protein, Human (HEK293, His) is the recombinant human-derived TRGC2 protein, expressed by HEK293, with C-His tag.
Product Specifications
Product Name Alternative
TRGC2 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Smiles
DKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDIIKIHWQEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEESLDKEHRCIVRHENNKNGIDQEIIFPPIKTDVTTVDPKYNYSKDANDVITMDPKDNWSKDANDTLLLQLTNTSA
Molecular Formula
/ (Gene_ID) P03986 (D1-A154) (Accession)
Molecular Weight
Approximately 30-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![IL-2 Mouse Monoclonal Antibody [A8B8]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea81028/imageurl/ha601015.webp)