Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRGC2, Human (HEK293, His)

TRGC2 Protein, Human (HEK293, His) is the recombinant human-derived TRGC2 protein, expressed by HEK293, with C-His tag.

Product Specifications

Product Name Alternative

TRGC2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Smiles

DKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDIIKIHWQEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEESLDKEHRCIVRHENNKNGIDQEIIFPPIKTDVTTVDPKYNYSKDANDVITMDPKDNWSKDANDTLLLQLTNTSA

Molecular Formula

/ (Gene_ID) P03986 (D1-A154) (Accession)

Molecular Weight

Approximately 30-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGF Receptor 2 (KDR) (1057-1061) Rabbit Polyclonal Antibody
AP26071PU-N 100 µL

VEGF Receptor 2 (KDR) (1057-1061) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Optional propeller, stainless steel centrifugal impeller
IPS2050-P-S2 1 Each

Optional propeller, stainless steel centrifugal impeller

Sign In for Pricing
View Details
Mouse IL-3 Recombinant Rabbit monoclonal Antibody
HA723684 100 µL

Mouse IL-3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
(E)-Oct-4-ene-1,8-dioic Acid
TRC-O239103-500MG 500 mg

(E)-Oct-4-ene-1,8-dioic Acid

Sign In for Pricing
View Details
Recombinant Rat CD79B/B29 Protein (His Tag)
PKSR030227 100 µg

Recombinant Rat CD79B/B29 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Phospho-S6 Ribosomal Protein (Ser240, 244) Monoclonal Antibody
AN302078L-01 50 µL

Recombinant Phospho-S6 Ribosomal Protein (Ser240, 244) Monoclonal Antibody

Sign In for Pricing
View Details