Megalin, Human (HEK293, His)
LRP2/Megalin Protein, Human (HEK293, His) is the recombinant human-derived LRP2/Megalin protein, expressed by HEK293, with C-His tag.
Product Specifications
Product Name Alternative
LRP2/Megalin Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Purity
90.0
Smiles
PMCSSTQFLCANNEKCIPIWWKCDGQKDCSDGSDELALCPQRFCRLGQFQCSDGNCTSPQTLCNAHQNCPDGSDEDRLLCENHHCDSNEWQCANKRCIPESWQCDTFNDCEDNSDEDSSHCASRTCRPGQFRCANGRCIPQAWKCDVDNDCGDHSDEPIEECMSSAHLCDNFTEFSCKTNYRCIPKWAVCNGVDDCRDNSDEQGCEERTCHPVGDFRCKNHHCIPLRWQCDGQNDCGDNSDEENCAPRECTESEFRCVNQQCIPSRWICDHYNDCGDNSDERDCEMRTCHPEYFQCTSGHCVHSELKCDGSADCLDASDEADCPTRFPDGAYCQATMFECKNHVCIPPYWKCDGDDDCGDGSDEELHLCLDVPCNSPNRFRCDNNRCIYSHEVCNGVDDCGDGTDETEEHCRKPTPKPCTEYEYKCGNGHCIPHDNVCDDADDCGDWSDELGCNK
Molecular Formula
4036 (Gene_ID) P98164 (P3510-K3964) (Accession)
Molecular Weight
Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680034-500 1x 500 µL
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040948-500 1x 500 µL
Cytokeratin 5/8 (C-50), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740287-100 1x 100 µL
Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details