Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-15, Rat

IL-15 Protein, Rat is the recombinant rat-derived IL-15 protein, expressed by E. coli, with tag free tag.

Product Specifications

Product Name Alternative

IL-15 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Smiles

MNWIDVRYDLEKIESLIQFIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVIESGCKECEELEERNFTEFLQSFIHIVQMFINTS

Molecular Formula

25670 (Gene_ID) P97604-1 (N49-S162) with an N-terminal M (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actin Recombinant Rabbit Monoclonal Antibody [JJ09-29]
ET1701-80 100 µL

Actin Recombinant Rabbit Monoclonal Antibody [JJ09-29]

Sign In for Pricing
View Details
Tissue FFPE Sections, Duodenum
CS707885 5x 5 µm

Tissue FFPE Sections, Duodenum

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone
CS702408 5x 5 µm

Tissue FFPE Sections, Bone

Sign In for Pricing
View Details
EnzyFluo™ L-Lactate Assay Kit
EFLLC-100 100 Tests

EnzyFluo™ L-Lactate Assay Kit

Sign In for Pricing
View Details
HMGN2 Rabbit Polyclonal Antibody
TA370271 100 µL

HMGN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Aldh1a2 Mouse Gene Knockout Kit (CRISPR)
KN501112 1 Kit

Aldh1a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details