Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-15, Rat

IL-15 Protein, Rat is the recombinant rat-derived IL-15 protein, expressed by E. coli, with tag free tag.

Product Specifications

Product Name Alternative

IL-15 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Smiles

MNWIDVRYDLEKIESLIQFIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVIESGCKECEELEERNFTEFLQSFIHIVQMFINTS

Molecular Formula

25670 (Gene_ID) P97604-1 (N49-S162) with an N-terminal M (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASAP1 Human Gene Knockout Kit (CRISPR)
KN417979 1 Kit

ASAP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KCNMB3 (NM_001163677) Human Over-expression Lysate
LC431138 20 µg

KCNMB3 (NM_001163677) Human Over-expression Lysate

Sign In for Pricing
View Details
Levomoramide
TRC-L646465-10MG 10 mg

Levomoramide

Sign In for Pricing
View Details
BAG5 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E5]
TA811740AM 100 µL

BAG5 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E5]

Sign In for Pricing
View Details
SIX3 Human Gene Knockout Kit (CRISPR)
KN416286 1 Kit

SIX3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VPS37A (NM_001145152) Human Over-expression Lysate
LC428727 20 µg

VPS37A (NM_001145152) Human Over-expression Lysate

Sign In for Pricing
View Details