SRXN1, Human (His, Myc)
SRXN1 Protein, Human (His, Myc) is the recombinant human-derived SRXN1 protein, expressed by E. coli, with N-10*His & C-Myc tag.
Product Specifications
Product Name Alternative
SRXN1 Protein, Human (His, Myc), Human, E. coli
UNSPSC
12352202
Smiles
MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQS
Molecular Formula
140809 (Gene_ID) Q9BYN0 (M1-S120) (Accession)
Molecular Weight
Approximately 20-25 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
P11051 1000 Units/Pack
Pipette Filter tips, 0.2-10 uL Extended, Low Retention, Natural, Bulk, DNase/RNase free - 1000 un. - ABDOS
Ask
View Details