Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRXN1, Human (His, Myc)

SRXN1 Protein, Human (His, Myc) is the recombinant human-derived SRXN1 protein, expressed by E. coli, with N-10*His & C-Myc tag.

Product Specifications

Product Name Alternative

SRXN1 Protein, Human (His, Myc), Human, E. coli

UNSPSC

12352202

Smiles

MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQS

Molecular Formula

140809 (Gene_ID) Q9BYN0 (M1-S120) (Accession)

Molecular Weight

Approximately 20-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-OSMR Polyclonal Antibody
HV716014-01 50 µg

Anti-OSMR Polyclonal Antibody

Ask
View Details
Anti-OSMR Polyclonal Antibody
HV716014-02 100 µg

Anti-OSMR Polyclonal Antibody

Ask
View Details
FBX41, NT (FBXO41, FBX41, KIAA1940, F-box only protein 41) (MaxLight 750) discontinued
035536-ML750 100 µL

FBX41, NT (FBXO41, FBX41, KIAA1940, F-box only protein 41) (MaxLight 750) discontinued

Ask
View Details
NGDN (NM_001042635) Human Over-expression Lysate
LY421013 100 µg

NGDN (NM_001042635) Human Over-expression Lysate

Ask
View Details
Human MAP Kinase-Activated Protein Kinase 3 (MAPKAPK3) Protein
abx073468-01 5 µg

Human MAP Kinase-Activated Protein Kinase 3 (MAPKAPK3) Protein

Ask
View Details
Human MAP Kinase-Activated Protein Kinase 3 (MAPKAPK3) Protein
abx073468-02 20 µg

Human MAP Kinase-Activated Protein Kinase 3 (MAPKAPK3) Protein

Ask
View Details