Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RELM beta, Human (His)

Product Specifications

Product Name Alternative

RELM beta Protein, Human (His), Human, E. coli

UNSPSC

12352202

Smiles

MQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT

Molecular Formula

84666 (Gene_ID) Q9BQ08 (Q24-T111) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prl3a1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
37681154 3x 1.0 µg DNA

Prl3a1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
IL4 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV675414 1.0 µg DNA

IL4 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Anti-EPM2AIP1
Y158175 100 µL

Anti-EPM2AIP1

Sign In for Pricing
View Details
C21orf129 sgRNA CRISPR Lentivector (Human) (Target 1)
K0344502 1.0 µg DNA

C21orf129 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Hexokinase II (HK2) Mouse Monoclonal Antibody [Clone ID: 3B9-F8-F10]
TA346965 100 µL

Hexokinase II (HK2) Mouse Monoclonal Antibody [Clone ID: 3B9-F8-F10]

Sign In for Pricing
View Details
Tyrosine Hydroxylase (pS19) Antibody
abx133045-01 30 µL

Tyrosine Hydroxylase (pS19) Antibody

Sign In for Pricing
View Details