LIN28A, Human (His, SUMO)
LIN28A Protein, Human (His, SUMO) is the recombinant human-derived LIN28A protein, expressed by E. coli, with N-6*His & N-SUMO tag.
Product Specifications
Product Name Alternative
LIN28A Protein, Human (His, SUMO), Human, E. coli
UNSPSC
12352202
Smiles
MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
Molecular Formula
79727 (Gene_ID) Q9H9Z2 (M1-N209) (Accession)
Molecular Weight
Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
17037-AAT 25 nmoles
Fluorescein-12-dGTP *1 mM in Tris Buffer (pH 7.5) *
Sign In for Pricing
View Details