Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCN5, Human (His)

CCN5 Protein, Human (His) is the recombinant human-derived CCN5 protein, expressed by E. coli, with C-10*His tag.

Product Specifications

Product Name Alternative

CCN5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Purity

98.0

Smiles

MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF

Molecular Formula

8839 (Gene_ID) O76076 (M1-F250) (Accession)

Molecular Weight

Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGOLN2 siRNA (Human)
orb1861027-01 15 nmol

TGOLN2 siRNA (Human)

Sign In for Pricing
View Details
TGOLN2 siRNA (Human)
orb1861027-02 30 nmol

TGOLN2 siRNA (Human)

Sign In for Pricing
View Details
Lentiviral human GLCCI1 sgRNA gene knockout kit - Lentiviral human GLCCI1 sgRNA gene knockout kit (25)
GTR15380043 1 Vial

Lentiviral human GLCCI1 sgRNA gene knockout kit - Lentiviral human GLCCI1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Translation initiation factor IF-2 (infB), partial
MBS1079689 Inquire

Recombinant Haemophilus influenzae Translation initiation factor IF-2 (infB), partial

Sign In for Pricing
View Details
YTHDF3 Antibody
A60452-50UG 50 µg

YTHDF3 Antibody

Sign In for Pricing
View Details
Recombinant Rat IL-10 Protein (His-tag)
GB300011-R-10μg 10 μg

Recombinant Rat IL-10 Protein (His-tag)

Sign In for Pricing
View Details