Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCN5, Human (His)

CCN5 Protein, Human (His) is the recombinant human-derived CCN5 protein, expressed by E. coli, with C-10*His tag.

Product Specifications

Product Name Alternative

CCN5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Purity

98.0

Smiles

MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF

Molecular Formula

8839 (Gene_ID) O76076 (M1-F250) (Accession)

Molecular Weight

Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAR1B (NM_016103) Human Over-expression Lysate
LY402500 100 µg

SAR1B (NM_016103) Human Over-expression Lysate

Sign In for Pricing
View Details
RTL5 (NM_001024455) Human Recombinant Protein
TP323344 20 µg

RTL5 (NM_001024455) Human Recombinant Protein

Sign In for Pricing
View Details
VPS28 Recombinant Rabbit Monoclonal Antibody [JE55-08]
ET7110-94 100 µL

VPS28 Recombinant Rabbit Monoclonal Antibody [JE55-08]

Sign In for Pricing
View Details
TentaGel® M OH
M303000.5G 5 g

TentaGel® M OH

Sign In for Pricing
View Details
CF®543 Succinimidyl Ester
#92105 1x 1 µmol

CF®543 Succinimidyl Ester

Sign In for Pricing
View Details
C4orf17 (NM_032149) Human Recombinant Protein
TP310369M 100 µg

C4orf17 (NM_032149) Human Recombinant Protein

Sign In for Pricing
View Details