Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOX, Human (sf9, His, MBP)

LOX proteins play a critical role in the post-translational oxidative deamination of peptidyl lysine residues in collagen and elastin precursors, thereby shaping extracellular matrix dynamics. It regulates Ras expression, suggesting potential tumor suppressive effects, affecting cellular homeostasis and cancer-related processes. LOX Protein, Human (sf9, His, MBP) is the recombinant human-derived LOX protein, expressed by Sf9 insect cells, with C-6*His and N-MBP labeled tag.

Product Specifications

Product Name Alternative

LOX Protein, Human (sf9, His, MBP), Human, Sf9 insect cells

UNSPSC

12352202

Smiles

DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

Molecular Formula

4015 (Gene_ID) P28300 (D169-Y417) (Accession)

Molecular Weight

Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SLC6A4 (Solute Carrier Family 6 Member 4, Sodium-dependent Serotonin Transporter, 5HT Transporter, 5HTT, HTT, SERT) (HRP)
133511-HRP 100 µL

SLC6A4 (Solute Carrier Family 6 Member 4, Sodium-dependent Serotonin Transporter, 5HT Transporter, 5HTT, HTT, SERT) (HRP)

Ask
View Details
ADAT2 (NM_001286259) Human Tagged ORF Clone
RC236014 10 µg

ADAT2 (NM_001286259) Human Tagged ORF Clone

Ask
View Details
Mouse Transmembrane Protein 158 (TMEM158) ELISA Kit
MBS9716802-01 48 Tests

Mouse Transmembrane Protein 158 (TMEM158) ELISA Kit

Ask
View Details
Mouse Transmembrane Protein 158 (TMEM158) ELISA Kit
MBS9716802-02 96 Tests

Mouse Transmembrane Protein 158 (TMEM158) ELISA Kit

Ask
View Details
Mouse Transmembrane Protein 158 (TMEM158) ELISA Kit
MBS9716802-03 5x 96 Tests

Mouse Transmembrane Protein 158 (TMEM158) ELISA Kit

Ask
View Details
Recombinant Shigella flexneri Uncharacterized protein ybjN (ybjN)
MBS1132458-01 0.02 mg (E-Coli)

Recombinant Shigella flexneri Uncharacterized protein ybjN (ybjN)

Ask
View Details