Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOX, Human (sf9, His, MBP)

LOX proteins play a critical role in the post-translational oxidative deamination of peptidyl lysine residues in collagen and elastin precursors, thereby shaping extracellular matrix dynamics. It regulates Ras expression, suggesting potential tumor suppressive effects, affecting cellular homeostasis and cancer-related processes. LOX Protein, Human (sf9, His, MBP) is the recombinant human-derived LOX protein, expressed by Sf9 insect cells, with C-6*His and N-MBP labeled tag.

Product Specifications

Product Name Alternative

LOX Protein, Human (sf9, His, MBP), Human, Sf9 insect cells

UNSPSC

12352202

Smiles

DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

Molecular Formula

4015 (Gene_ID) P28300 (D169-Y417) (Accession)

Molecular Weight

Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

EXOSC4 (NM_019037) Human 3' UTR Clone
SC200611 10 µg

EXOSC4 (NM_019037) Human 3' UTR Clone

Ask
View Details
Ampalex (CX-516) 250mg
A12349-250 250 mg

Ampalex (CX-516) 250mg

Ask
View Details
CX001, CT (CXorf1, Uncharacterized protein CXorf1) (Biotin) discontinued
034376-Biotin 200 µL

CX001, CT (CXorf1, Uncharacterized protein CXorf1) (Biotin) discontinued

Ask
View Details
Anti-ERBB3 (Duligotumab)-SMCC-DM1 ADC
ADC-W-2240 1 mg

Anti-ERBB3 (Duligotumab)-SMCC-DM1 ADC

Ask
View Details
pBluescriptR-EFCAB13 Plasmid
PVT21417 2 µg

pBluescriptR-EFCAB13 Plasmid

Ask
View Details
Mouse Monoclonal Fc gamma RI/CD64 Antibody (276426) [mFluor Violet 450 SE]
FAB12571MFV450 0.1 mL

Mouse Monoclonal Fc gamma RI/CD64 Antibody (276426) [mFluor Violet 450 SE]

Ask
View Details