Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOX, Human (C-His)

LOX proteins play a critical role in the post-translational oxidative deamination of peptidyl lysine residues in collagen and elastin precursors, thereby shaping extracellular matrix dynamics. It regulates Ras expression, suggesting potential tumor suppressive effects, affecting cellular homeostasis and cancer-related processes. LOX Protein, Human (C-His) is the recombinant human-derived LOX protein, expressed by E. coli, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LOX Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Smiles

PYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

Molecular Formula

4015 (Gene_ID) P28300 (P174-Y417) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MANBB AAV siRNA Pooled Vector
27993161 1.0 μg

MANBB AAV siRNA Pooled Vector

Ask
View Details
AHSA2 Protein Lysate (Rat) with C-HA Tag
11564036 100 μg

AHSA2 Protein Lysate (Rat) with C-HA Tag

Ask
View Details
Lentiviral mouse Trmt2b shRNA (UAS) - Lentiviral mouse Trmt2b shRNA (UAS, iRFP) (25)
GTR15216314 1 Vial

Lentiviral mouse Trmt2b shRNA (UAS) - Lentiviral mouse Trmt2b shRNA (UAS, iRFP) (25)

Ask
View Details
Nedd8 AAV Vector (Human) (CMV)
31684101 1 μg

Nedd8 AAV Vector (Human) (CMV)

Ask
View Details
3-Fluoro-4-[ (morpholin-4-yl) carbonyl]phenylboronic acid
PC412459-01 250 mg

3-Fluoro-4-[ (morpholin-4-yl) carbonyl]phenylboronic acid

Ask
View Details
3-Fluoro-4-[ (morpholin-4-yl) carbonyl]phenylboronic acid
PC412459-02 1 g

3-Fluoro-4-[ (morpholin-4-yl) carbonyl]phenylboronic acid

Ask
View Details