Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPARD, Human (His)

PPARD protein is a ligand-activated transcription factor that critically mediates energy metabolism in adipose tissue. As a receptor, it selectively binds peroxisome proliferators, including hypolipidemic drugs and fatty acids, and preferentially binds polyunsaturated substances. PPARD Protein, Human (His) is the recombinant human-derived PPARD protein, expressed by E. coli, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PPARD Protein, Human (His), Human, E. coli

UNSPSC

12352202

Purity

90.00

Smiles

QVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY

Molecular Formula

5467 (Gene_ID) Q03181-1 (Q171-Y441) (Accession)

Molecular Weight

Approximately 28-33 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Setd6 AAV siRNA Pooled Vector
43526166 1.0 µg

Setd6 AAV siRNA Pooled Vector

Ask
View Details
Human Anillin (ANLN) activation kit by CRISPRa
GA110104 1 Kit

Human Anillin (ANLN) activation kit by CRISPRa

Ask
View Details
Rabbit Polyclonal GTF2H2 Antibody
NBP2-87537 100 µL

Rabbit Polyclonal GTF2H2 Antibody

Ask
View Details
Bag of 100 Discs Nylon Mesh Filter 40µm, 47 Mm (Hot Cutted)
TF040NY0047AC Bag of 100

Bag of 100 Discs Nylon Mesh Filter 40µm, 47 Mm (Hot Cutted)

Ask
View Details
Albumin, Human Serum (ALB, DKFZp779N1935, PRO0883, PRO0903, PRO1341) discontinued
209470-01 20 µL

Albumin, Human Serum (ALB, DKFZp779N1935, PRO0883, PRO0903, PRO1341) discontinued

Ask
View Details
Albumin, Human Serum (ALB, DKFZp779N1935, PRO0883, PRO0903, PRO1341) discontinued
209470-02 100 µL

Albumin, Human Serum (ALB, DKFZp779N1935, PRO0883, PRO0903, PRO1341) discontinued

Ask
View Details