PPARD, Human (His)
PPARD protein is a ligand-activated transcription factor that critically mediates energy metabolism in adipose tissue. As a receptor, it selectively binds peroxisome proliferators, including hypolipidemic drugs and fatty acids, and preferentially binds polyunsaturated substances. PPARD Protein, Human (His) is the recombinant human-derived PPARD protein, expressed by E. coli, with N-6*His labeled tag.
Product Specifications
Product Name Alternative
PPARD Protein, Human (His), Human, E. coli
UNSPSC
12352202
Purity
90.00
Smiles
QVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
Molecular Formula
5467 (Gene_ID) Q03181-1 (Q171-Y441) (Accession)
Molecular Weight
Approximately 28-33 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LH15315V 100 µg
SIX6OS1 (C14orf39) (NM_174978) Human Over-expression Lysate
Sign In for Pricing
View Details MBS731431-01 48 Well
Rat cation channel sperm-associated protein 3 (SPER3) ELISA Kit
Sign In for Pricing
View Details MBS731431-02 96 Well
Rat cation channel sperm-associated protein 3 (SPER3) ELISA Kit
Sign In for Pricing
View Details