Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPARD, Human (His)

PPARD protein is a ligand-activated transcription factor that critically mediates energy metabolism in adipose tissue. As a receptor, it selectively binds peroxisome proliferators, including hypolipidemic drugs and fatty acids, and preferentially binds polyunsaturated substances. PPARD Protein, Human (His) is the recombinant human-derived PPARD protein, expressed by E. coli, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PPARD Protein, Human (His), Human, E. coli

UNSPSC

12352202

Purity

90.00

Smiles

QVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY

Molecular Formula

5467 (Gene_ID) Q03181-1 (Q171-Y441) (Accession)

Molecular Weight

Approximately 28-33 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal IL-18 BPa/IL18BP Antibody (MM0379-10G36) [DyLight 680]
NBP2-11678FR 0.1 mL

Mouse Monoclonal IL-18 BPa/IL18BP Antibody (MM0379-10G36) [DyLight 680]

Ask
View Details
alpha Synuclein Rabbit mAb
MBS4762607-01 0.1 mL

alpha Synuclein Rabbit mAb

Ask
View Details
alpha Synuclein Rabbit mAb
MBS4762607-02 5x 0.1 mL

alpha Synuclein Rabbit mAb

Ask
View Details
Rat Cdc45 Pre-designed siRNA Set A
SI202379A 1 Each

Rat Cdc45 Pre-designed siRNA Set A

Ask
View Details
Sele (NM_138879) Rat Tagged Lenti ORF Clone
RR210903L3 10 µg

Sele (NM_138879) Rat Tagged Lenti ORF Clone

Ask
View Details
Rabbit Polyclonal RKHD3 Antibody [FITC]
NBP2-81777F 0.1 mL

Rabbit Polyclonal RKHD3 Antibody [FITC]

Ask
View Details