TMCO1, Human (Cell-Free, His)
TMCO1 Protein, Human (Cell-Free, His) is the recombinant human-derived TMCO1 protein, expressed by E. coli cell-free system, with N-10*His tag.
Product Specifications
Product Name Alternative
TMCO1 Protein, Human (Cell-Free, His), Human, E. coli Cell-free
UNSPSC
12352202
Purity
90.00
Smiles
STMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITESAGRQQKKKIERQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFTPLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS
Molecular Formula
54499 (Gene_ID) Q9UM00-1 (M1-S188) (Accession)
Molecular Weight
Approximately 23 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RDR-RBM38-Hu-01 96 Tests
Human RNA Binding Motif Protein 38 (RBM38) ELISA Kit
Sign In for Pricing
View Details RDR-RBM38-Hu-02 48 Tests
Human RNA Binding Motif Protein 38 (RBM38) ELISA Kit
Sign In for Pricing
View Details 
L-8011-1 1 mg
Pure Calystega sepiem Lectin (Hedge Bindweed Rhizomes) -Calsepa-
Sign In for Pricing
View Details