Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMCO1, Human (Cell-Free, His)

TMCO1 Protein, Human (Cell-Free, His) is the recombinant human-derived TMCO1 protein, expressed by E. coli cell-free system, with N-10*His tag.

Product Specifications

Product Name Alternative

TMCO1 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Purity

90.00

Smiles

STMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITESAGRQQKKKIERQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFTPLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS

Molecular Formula

54499 (Gene_ID) Q9UM00-1 (M1-S188) (Accession)

Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRMT7 Human Gene Knockout Kit (CRISPR)
KN401672 1 Kit

PRMT7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VEGFA Goat Polyclonal Antibody
AB0063-200 600 µg

VEGFA Goat Polyclonal Antibody

Sign In for Pricing
View Details
TAG-72 / CA72.4 (CC49), Biotin conjugate, 0.1mg/mL
BNCB0732-100 1x 100 µL

TAG-72 / CA72.4 (CC49), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SHPRH Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G8]
TA501447BM 100 µL

SHPRH Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G8]

Sign In for Pricing
View Details
PKC θ (Ab-538) Antibody
8B0719-AAT 50 µg

PKC θ (Ab-538) Antibody

Sign In for Pricing
View Details
rac-cis-Ambroxol
TRC-A575905-10MG 10 mg

rac-cis-Ambroxol

Sign In for Pricing
View Details