SLC39A1, Human (GST)
SLC39A1 Protein, Human (GST) is the recombinant human-derived SLC39A1 protein, expressed by E. coli, with N-GST tag.
Product Specifications
Product Name Alternative
SLC39A1 Protein, Human (GST), Human, E. coli
UNSPSC
12352202
Smiles
MEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALR
Molecular Formula
27173 (Gene_ID) Q9NY26 (M126-R179) (Accession)
Molecular Weight
Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
KN424460 1 Kit
eEF1A2 binding protein (IGFN1) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
