Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC39A1, Human (GST)

SLC39A1 Protein, Human (GST) is the recombinant human-derived SLC39A1 protein, expressed by E. coli, with N-GST tag.

Product Specifications

Product Name Alternative

SLC39A1 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Smiles

MEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALR

Molecular Formula

27173 (Gene_ID) Q9NY26 (M126-R179) (Accession)

Molecular Weight

Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Hydroxy Diclofenac
TRC-H825230-25MG 25 mg

5-Hydroxy Diclofenac

Sign In for Pricing
View Details
Ncs1 (NM_019681) Mouse Tagged ORF Clone
MG201801 10 µg

Ncs1 (NM_019681) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TGM2 Antibody
KC-950-01 50 μL

TGM2 Antibody

Sign In for Pricing
View Details
TGM2 Antibody
KC-950-02 100 µL

TGM2 Antibody

Sign In for Pricing
View Details
TGM2 Antibody
KC-950-03 1 mL

TGM2 Antibody

Sign In for Pricing
View Details
CF®555 Goat Anti-Mouse IgG3 (γ3), 2mg/mL
#20926-250uL 1x 250 µL

CF®555 Goat Anti-Mouse IgG3 (γ3), 2mg/mL

Sign In for Pricing
View Details