Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Decorin/PGS2, Bovine (His)

Decorin/PGS2 Protein, Bovine (His) is the recombinant bovine-derived Decorin/PGS2 protein, expressed by E. coli, with N-6*His tag.

Product Specifications

Product Name Alternative

Decorin/PGS2 Protein, Bovine (His), Bovine, E. coli

UNSPSC

12352202

Smiles

DEASGIGPEEHFPEVPEIEPMGPVCPFRCQCHLRVVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAVQLGNYK

Molecular Formula

280760 (Gene_ID) P21793 (D31-K360) (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF740 conjugate, 0.1mg/mL
BNC742289-500 1x 500 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MSI2 Recombinant Rabbit Monoclonal Antibody [PSH01-17]
HA721634 100 µL

MSI2 Recombinant Rabbit Monoclonal Antibody [PSH01-17]

Sign In for Pricing
View Details
PE Anti-Mouse CD20 Antibody[SA271G2]
E-AB-F1403D-01 50 Tests

PE Anti-Mouse CD20 Antibody[SA271G2]

Sign In for Pricing
View Details
PE Anti-Mouse CD20 Antibody[SA271G2]
E-AB-F1403D-02 100 Tests

PE Anti-Mouse CD20 Antibody[SA271G2]

Sign In for Pricing
View Details
PE Anti-Mouse CD20 Antibody[SA271G2]
E-AB-F1403D-03 2x 100 Tests

PE Anti-Mouse CD20 Antibody[SA271G2]

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F10]
TA808384AM 100 µL

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F10]

Sign In for Pricing
View Details