Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kras4B, Human (G13D, His)

The Kras4B protein interacts specifically with GPR31, dependent on farnesylation. This binding suggests a regulatory role for Kras4B in association with GPR31, emphasizing the importance of the farnesylation process. Comprehensive exploration into the molecular details of this interaction is crucial to understand the precise mechanisms and functional implications in cellular processes or signaling pathways. Kras4B Protein, Human (G13D, His) is the recombinant human-derived KRAS protein, expressed by E. coli, with N-His labeled tag.

Product Specifications

Product Name Alternative

Kras4B Protein, Human (G13D, His), Human, E. coli

UNSPSC

12352202

Purity

95.0

Smiles

TEYKLVVVGAGDVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

Molecular Formula

3845 (Gene_ID) P01116-2 (T2-C185) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NFIA, CT (NFIA, KIAA1439, Nuclear factor 1 A-type, CCAAT-box-binding transcription factor, Nuclear factor I/A, TGGCA-binding protein) (FITC) discontinued
038932-FITC 200 µL

NFIA, CT (NFIA, KIAA1439, Nuclear factor 1 A-type, CCAAT-box-binding transcription factor, Nuclear factor I/A, TGGCA-binding protein) (FITC) discontinued

Ask
View Details
Rat Monoclonal Pax5/BSAP Antibody (1H9) [Alexa Fluor 532]
NBP2-00258AF532 0.1 mL

Rat Monoclonal Pax5/BSAP Antibody (1H9) [Alexa Fluor 532]

Ask
View Details
Recombinant Rat IgE Protein
E55P6300 50 µg

Recombinant Rat IgE Protein

Ask
View Details
Biotin-Linked Antibody to Transforming Growth Factor Beta 1 (TGFb1)
MBS2002562-01 0.1 mL

Biotin-Linked Antibody to Transforming Growth Factor Beta 1 (TGFb1)

Ask
View Details
Biotin-Linked Antibody to Transforming Growth Factor Beta 1 (TGFb1)
MBS2002562-02 0.2 mL

Biotin-Linked Antibody to Transforming Growth Factor Beta 1 (TGFb1)

Ask
View Details
Biotin-Linked Antibody to Transforming Growth Factor Beta 1 (TGFb1)
MBS2002562-03 0.5 mL

Biotin-Linked Antibody to Transforming Growth Factor Beta 1 (TGFb1)

Ask
View Details