Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kras4B, Human (G13D, His)

The Kras4B protein interacts specifically with GPR31, dependent on farnesylation. This binding suggests a regulatory role for Kras4B in association with GPR31, emphasizing the importance of the farnesylation process. Comprehensive exploration into the molecular details of this interaction is crucial to understand the precise mechanisms and functional implications in cellular processes or signaling pathways. Kras4B Protein, Human (G13D, His) is the recombinant human-derived KRAS protein, expressed by E. coli, with N-His labeled tag.

Product Specifications

Product Name Alternative

Kras4B Protein, Human (G13D, His), Human, E. coli

UNSPSC

12352202

Purity

95.0

Smiles

TEYKLVVVGAGDVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

Molecular Formula

3845 (Gene_ID) P01116-2 (T2-C185) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cotton Rat IL-1 beta/IL-1F2 Affinity Purified Polyclonal Ab
AF1009-SP 25 µg

Cotton Rat IL-1 beta/IL-1F2 Affinity Purified Polyclonal Ab

Ask
View Details
Rabbit anti-LYRIC/AEGl Recombinant Monoclonal Antibody [BLR258L]
A700-258 100 µL (50+ Tests)

Rabbit anti-LYRIC/AEGl Recombinant Monoclonal Antibody [BLR258L]

Ask
View Details
NativeExtract™ Human TLR9 Membrane Protein (Full length, Super Nanodisc)
S01YF-1023-KX454 10 μg

NativeExtract™ Human TLR9 Membrane Protein (Full length, Super Nanodisc)

Ask
View Details
POLE4 Peptide - N-terminal region
MBS3229564-01 0.1 mg

POLE4 Peptide - N-terminal region

Ask
View Details
POLE4 Peptide - N-terminal region
MBS3229564-02 5x 0.1 mg

POLE4 Peptide - N-terminal region

Ask
View Details
AdmiRa-mmu-miR-592-5p-Off Virus
mm5866 1.0 mL

AdmiRa-mmu-miR-592-5p-Off Virus

Ask
View Details