Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neurogranin, Human (His)

Neurogranin Protein, Human (His) is the recombinant human-derived Neurogranin protein, expressed by E. coli, with N-His tag.

Product Specifications

Product Name Alternative

Neurogranin Protein, Human (His), Human, E. coli

UNSPSC

12352202

Smiles

MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD

Molecular Formula

4900 (Gene_ID) Q92686 (M1-D78) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 700 Anti-Human HLA-A, B, C Antibody[W6/32]
E-AB-F1130M1-01 20 Tests

Elab Fluor® 700 Anti-Human HLA-A, B, C Antibody[W6/32]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human HLA-A, B, C Antibody[W6/32]
E-AB-F1130M1-02 100 Tests

Elab Fluor® 700 Anti-Human HLA-A, B, C Antibody[W6/32]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human HLA-A, B, C Antibody[W6/32]
E-AB-F1130M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human HLA-A, B, C Antibody[W6/32]

Sign In for Pricing
View Details
FUNDC1 Recombinant Rabbit Monoclonal Antibody [PSH0-92]
HA721530 100 µL

FUNDC1 Recombinant Rabbit Monoclonal Antibody [PSH0-92]

Sign In for Pricing
View Details
C6orf114 (NM_033069) Human Over-expression Lysate
LC403223 20 µg

C6orf114 (NM_033069) Human Over-expression Lysate

Sign In for Pricing
View Details
PRAMEF18 Human Gene Knockout Kit (CRISPR)
KN418336 1 Kit

PRAMEF18 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details