Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC1A5/ASCT2, Human (HEK293, His, TrxA)

SLC1A5/ASCT2 Protein, Human (HEK293, His, TrxA) is the recombinant human-derived SLC1A5 protein, expressed by E. coli, with N-His & N-TrxA tag.

Product Specifications

Product Name Alternative

SLC1A5/ASCT2 Protein, Human (HEK293, His, TrxA), Human, E. coli

UNSPSC

12352202

Smiles

QPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRSYSTTYEERNITGTRVKVPVGQ

Molecular Formula

6510 (Gene_ID) Q15758-1 (Q154-Q224) (Accession)

Molecular Weight

Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
BNC881081-100 1x 100 µL

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
BNC400034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-100 1x 100 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-1 (SM1/495), CF568 conjugate, 0.1mg/mL
BNC680495-100 1x 100 µL

SUMO-1 (SM1/495), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (197-2B1), CF568 conjugate, 0.1mg/mL
BNC680931-500 1x 500 µL

CD46 (197-2B1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (PTPRC/1783R), CF640R conjugate, 0.1mg/mL
BNC401783-100 1x 100 µL

CD45RB (B-Cell Marker) (PTPRC/1783R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details