SLC1A5/ASCT2, Human (HEK293, His, TrxA)
SLC1A5/ASCT2 Protein, Human (HEK293, His, TrxA) is the recombinant human-derived SLC1A5 protein, expressed by E. coli, with N-His & N-TrxA tag.
Product Specifications
Product Name Alternative
SLC1A5/ASCT2 Protein, Human (HEK293, His, TrxA), Human, E. coli
UNSPSC
12352202
Smiles
QPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRSYSTTYEERNITGTRVKVPVGQ
Molecular Formula
6510 (Gene_ID) Q15758-1 (Q154-Q224) (Accession)
Molecular Weight
Approximately 24 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog