TMEM119, Human (P. pastoris, His)
The TMEM119 protein is critical in bone formation and helps myoblasts differentiate into osteoblasts. It induces commitment and differentiation by enhancing BMP2 production and interacting with the BMP-RUNX2 pathway. TMEM119 Protein, Human (P. pastoris, His) is the recombinant human-derived TMEM119 protein, expressed by P. pastoris, with N-6*His labeled tag.
Product Specifications
Product Name Alternative
TMEM119 Protein, Human (P. pastoris, His), Human, P. pastoris
UNSPSC
12352202
Purity
98.00
Smiles
RSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQPITLGGPSPPTNFLDGIVDFFRQYVM
Molecular Formula
338773 (Gene_ID) Q4V9L6 (R26-M96) (Accession)
Molecular Weight
Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL
CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL
CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
