TRDC, Human (HEK293, His)
TRDC Protein, Human (HEK293, His) is the recombinant human-derived TRDC protein, expressed by HEK293, with C-His tag.
Product Specifications
Product Name Alternative
TRDC Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Smiles
SQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTV
Molecular Formula
/ (Gene_ID) B7Z8K6 (S1-V129) (Accession)
Molecular Weight
Approximately 27-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740708-500 1x 500 µL
Kappa Light Chain (TB28-2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-E918115-25MG 25 mg
2-(2-(3-(N-Ethylacetamido)phenyl)-1,3-dioxolan-2-yl)acetic Acid
Sign In for Pricing
View Details 
