TRDC, Human (HEK293, His)
TRDC Protein, Human (HEK293, His) is the recombinant human-derived TRDC protein, expressed by HEK293, with C-His tag.
Product Specifications
Product Name Alternative
TRDC Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Smiles
SQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTV
Molecular Formula
/ (Gene_ID) B7Z8K6 (S1-V129) (Accession)
Molecular Weight
Approximately 27-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY400234 100 µg
5 Lipoxygenase (ALOX5) (NM_000698) Human Over-expression Lysate
Sign In for Pricing
View Details 
