TRGC1, Human (HEK293, His)
TRBC1 Protein, Human (HEK293, His) is the recombinant human-derived TRBC1 protein, expressed by HEK293, with C-His tag.
Product Specifications
Product Name Alternative
TRGC1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Smiles
DKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWQEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPKDNCSKDANDTLLLQLTNTSA
Molecular Formula
/ (Gene_ID) P0CF51 (D1-A138) (Accession)
Molecular Weight
Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680460-100 1x 100 µL
CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680493-100 1x 100 µL
Moesin (MSN/493), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details