Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRBC2, Human (HEK293, His)

TRBC2 Protein, Human (HEK293, His) is the recombinant human-derived TRBC2 protein, expressed by HEK293, with C-His tag.

Product Specifications

Product Name Alternative

TRBC2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Smiles

DLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSA

Molecular Formula

/ (Gene_ID) A0A5B9 (D1-A144) (Accession)

Molecular Weight

Approximately 19-21 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Anti-Mouse Kruppel-like factor 2 (KLF2) (KLF2- phospho) IgG (aff pure)
AB-23090-A 100 µg

Rabbit Anti-Mouse Kruppel-like factor 2 (KLF2) (KLF2- phospho) IgG (aff pure)

Ask
View Details
HIRIP3 (D-10) Alexa Fluor® 594
sc-376814 AF594 200 µg/mL

HIRIP3 (D-10) Alexa Fluor® 594

Ask
View Details
Recombinant Human FAM90A15P Protein
E30P9894 20 µg

Recombinant Human FAM90A15P Protein

Ask
View Details
PE anti-human CD27
GT07517 25 Tests

PE anti-human CD27

Ask
View Details
GPR7 Polyclonal Antibody, RBITC Conjugated
bs-8618R-RBITC 100 µL

GPR7 Polyclonal Antibody, RBITC Conjugated

Ask
View Details