Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRBC2, Human (HEK293, His)

TRBC2 Protein, Human (HEK293, His) is the recombinant human-derived TRBC2 protein, expressed by HEK293, with C-His tag.

Product Specifications

Product Name Alternative

TRBC2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Smiles

DLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSA

Molecular Formula

/ (Gene_ID) A0A5B9 (D1-A144) (Accession)

Molecular Weight

Approximately 19-21 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Monkey Elongation of Very Long Chain Fatty Acids Protein 4 (ELOVL4) ELISA Kit
MBS9906873-01 48 Well

Monkey Elongation of Very Long Chain Fatty Acids Protein 4 (ELOVL4) ELISA Kit

Ask
View Details
Monkey Elongation of Very Long Chain Fatty Acids Protein 4 (ELOVL4) ELISA Kit
MBS9906873-02 96 Well

Monkey Elongation of Very Long Chain Fatty Acids Protein 4 (ELOVL4) ELISA Kit

Ask
View Details
Monkey Elongation of Very Long Chain Fatty Acids Protein 4 (ELOVL4) ELISA Kit
MBS9906873-03 5x 96 Well

Monkey Elongation of Very Long Chain Fatty Acids Protein 4 (ELOVL4) ELISA Kit

Ask
View Details
Monkey Elongation of Very Long Chain Fatty Acids Protein 4 (ELOVL4) ELISA Kit
MBS9906873-04 10x 96 Well

Monkey Elongation of Very Long Chain Fatty Acids Protein 4 (ELOVL4) ELISA Kit

Ask
View Details
RING1 (RING Finger Protein 1, Ring1A, RNF1) (HRP)
MBS6181814-01 0.1 mL

RING1 (RING Finger Protein 1, Ring1A, RNF1) (HRP)

Ask
View Details
RING1 (RING Finger Protein 1, Ring1A, RNF1) (HRP)
MBS6181814-02 5x 0.1 mL

RING1 (RING Finger Protein 1, Ring1A, RNF1) (HRP)

Ask
View Details