TRBC2, Human (HEK293, His)
TRBC2 Protein, Human (HEK293, His) is the recombinant human-derived TRBC2 protein, expressed by HEK293, with C-His tag.
Product Specifications
Product Name Alternative
TRBC2 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Smiles
DLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSA
Molecular Formula
/ (Gene_ID) A0A5B9 (D1-A144) (Accession)
Molecular Weight
Approximately 19-21 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![CD279 Antibody [J43.1] (PE)](https://cdn.genprice.uk/genprice/genprice3.png)
